Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DIP2A Antibody, Novus Biologicals™

DIP2A Antibody, Novus Biologicals™
SDP

Catalog No. NBP156909 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156909 100 μL
NBP15690920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156909 Supplier Novus Biologicals Supplier No. NBP156909
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

DIP2A Polyclonal specifically detects DIP2A in Human samples. It is validated for Western Blot.

Specifications

Antigen DIP2A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q14689
Gene Alias Dip2, DIP2 disco-interacting protein 2 homolog A (Drosophila), DIP2 homolog A, DIP2C21orf106, disco-interacting protein 2 homolog A, disco-interacting protein 2A, KIAA0184chromosome 21 open reading frame 106
Gene Symbols DIP2A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23181
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Chicken: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.