DIP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156909

Catalog No. NBP156909

Description

DIP2A Polyclonal specifically detects DIP2A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DIP2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Dip2, DIP2 disco-interacting protein 2 homolog A (Drosophila), DIP2 homolog A, DIP2C21orf106, disco-interacting protein 2 homolog A, disco-interacting protein 2A, KIAA0184chromosome 21 open reading frame 106
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23181
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14689
• Gene Symbols: DIP2A
• Immunogen: Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG