Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DIP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	DIP2A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15690920 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15690920UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156909 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP156909	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

DIP2A Polyclonal specifically detects DIP2A in Human samples. It is validated for Western Blot.

Specifications

Antigen	DIP2A
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q14689
Gene ID (Entrez)	23181
Immunogen	Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	Dip2, DIP2 disco-interacting protein 2 homolog A (Drosophila), DIP2 homolog A, DIP2C21orf106, disco-interacting protein 2 homolog A, disco-interacting protein 2A, KIAA0184chromosome 21 open reading frame 106
Gene Symbols	DIP2A
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

DIP2A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents