DISP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159442

Catalog No. NBP159442

Description

DISP1 Polyclonal specifically detects DISP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DISP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DISPAFLJ43740, dispatched A, dispatched homolog 1 (Drosophila), DKFZp434I0428, MGC104180, MGC13130, MGC16796, protein dispatched homolog 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Chicken: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 85%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Pig, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96F81
• Gene Symbols: DISP1
• Immunogen: Synthetic peptides corresponding to DISP1(dispatched homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DISP1. Peptide sequence FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV.
• Quantity: 100 μL
• Research Discipline: Stem Cell Signaling Pathway
• Gene ID (Entrez): 84976
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only