Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DLG7/HURP Antibody, Novus Biologicals™

DLG7/HURP Antibody, Novus Biologicals™
SDP

Catalog No. NBP15464020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15464020 20 μL
NBP154640 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15464020 Supplier Novus Biologicals Supplier No. NBP15464020UL

Description

Rabbit Polyclonal Antibody

DLG7/HURP Polyclonal specifically detects DLG7/HURP in Human samples. It is validated for Western Blot.

Specifications

Antigen DLG7/HURP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15398
Gene Alias DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7
Gene Symbols DLGAP5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DLG7/HURP The peptide sequence was selected from the N terminal of DLG7/HURP. Peptide sequence EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG.
Molecular Weight of Antigen 95 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 9787
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.