DLL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159217

Catalog No. NBP159217

Description

DLL1 Polyclonal antibody specifically detects DLL1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: DLL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Delta, delta (Drosophila)-like 1, Delta1, delta-like 1 (Drosophila), delta-like protein 1, DL1, Drosophila Delta homolog 1, H-Delta-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 78 kDa
• Quantity: 100 μL
• Research Discipline: Neuroscience, Stem Cell Signaling Pathway
• Gene ID (Entrez): 28514
• Target Species: Human, Rat, Rat, Pig, Bovine, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O00548
• Gene Symbols: DLL1
• Immunogen: Synthetic peptides corresponding to DLL1(delta-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of DLL1. Peptide sequence GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only