DMBT1/GP340 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238471

Catalog No. NBP238471

Description

DMBT1/GP340 Polyclonal specifically detects DMBT1/GP340 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DMBT1/GP340
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9UGM3
• Gene Symbols: DMBT1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer
• Gene ID (Entrez): 1755
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: deleted in malignant brain tumors 1, deleted in malignant brain tumors 1 protein, FLJ61058, Glycoprotein 340, gp-340, GP340muclin, Hensin, MGC164738, SAG, Salivary agglutinin, Surfactant pulmonary-associated D-binding protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.