Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNA helicase B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15726720UL
Description
DNA helicase B Polyclonal specifically detects DNA helicase B in Human samples. It is validated for Western Blot.Specifications
DNA helicase B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8NG08 | |
HELB | |
Synthetic peptides corresponding to DNA helicase B The peptide sequence was selected from the N terminal of DNA helicase B. Peptide sequence FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DNA helicase B, hDHB, helicase (DNA) B | |
Rabbit | |
Protein A purified | |
RUO | |
92797 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction