Learn More
DNA Polymerase gamma Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | DNA Polymerase gamma |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | DNA polymerase subunit gamma-1, EC 2.7.7.7, FLJ27114, MDP1, MIRAS, Mitochondrial DNA polymerase catalytic subunit, MTDPS4A, PolG, catalytic subunit, POLG1MTDPS4B, PolG-alpha, POLGAPEO, polymerase (DNA directed), gamma, SANDO, SCAE |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.