Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNA Polymerase lambda Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317833100UL
This item is not returnable.
View return policy
Description
DNA Polymerase lambda Polyclonal antibody specifically detects DNA Polymerase lambda in Human samples. It is validated for ImmunofluorescenceSpecifications
DNA Polymerase lambda | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
BETAN, DNA polymerase beta-2, DNA polymerase beta-N, DNA polymerase kappa, DNA polymerase lambda, EC 2.7.7.7, EC 4.2.99.-, FLJ46002, Pol beta2, Pol Lambda, POLKAPPA, polymerase (DNA directed), lambda | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD | |
100 μg | |
Adaptive Immunity, DNA Polymerases, DNA Repair, Immunology | |
27343 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction