DNA polymerase mu Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324794

Catalog No. NB301658

Description

DNA polymerase mu Polyclonal antibody specifically detects DNA polymerase mu in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: DNA polymerase mu
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: DNA polymerase mu, DNA-directed DNA/RNA polymerase mu, EC 2.7.7.7, FLJ35482, Pol iota, Pol Mu, polmu, polymerase (DNA directed), mu, polymerase (DNA-directed), mu, Tdt-N, Terminal transferase
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein DNA polymerase mu using the following amino acid sequence: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
• Quantity: 100 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 27434
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified