Learn More
Description
Specifications
Specifications
| Antigen | DNAH17 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | axonemal dynein heavy chain, axonemal dynein heavy chain-like protein 1, ciliary dynein heavy chain 17, ciliary dynein heavy chain-like protein 1, DNAHL1, DNEL2, dynein heavy chain 17, axonemal, dynein light chain 2, axonemal, dynein, axonemal, heavy chain 17, dynein, axonemal, heavy chain like 1, dynein, axonemal, heavy like 1, dynein, axonemal, heavy polypeptide 17, FLJ40457, MGC132767, MGC138489 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
