DNAJB12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159444

Catalog No. NBP159444

Description

DNAJB12 Polyclonal specifically detects DNAJB12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNAJB12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Chicken: 92%; Pig: 92%; Rabbit: 92%; Goat: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9NXW2
• Gene Symbols: DNAJB12
• Immunogen: Synthetic peptides corresponding to DNAJB12(DnaJ (Hsp40) homolog, subfamily B, member 12) The peptide sequence was selected from the middle region of DNAJB12. Peptide sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54788
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.