Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16260220

DNAJC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16260220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16260220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16260220 Supplier Novus Biologicals Supplier No. NBP16260220UL

Description

Rabbit Polyclonal Antibody

DNAJC1 Polyclonal specifically detects DNAJC1 in Human samples. It is validated for Western Blot.

Specifications

Antigen DNAJC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96KC8
Gene Alias DnaJ (Hsp40) homolog, subfamily C, member 1, dnaJ homolog subfamily C member 1, DnaJ protein homolog MTJ1, DNAJL1, DnaJ-like protein, ERdj1, HTJ1, MGC131954, MTJ1
Gene Symbols DNAJC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DNAJC1(DnaJ (Hsp40) homolog, subfamily C, member 1) The peptide sequence was selected form the C terminal of DNAJC1. Peptide sequence ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64215
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.