Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15771820UL
Description
DNAJC12 Polyclonal specifically detects DNAJC12 in Human samples. It is validated for Western Blot.Specifications
| DNAJC12 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9UKB3 | |
| DNAJC12 | |
| Synthetic peptides corresponding to DNAJC12 (DnaJ (Hsp40) homolog, subfamily C, member 12) The peptide sequence was selected from the middle region of DNAJC12)(50ug). Peptide sequence EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DnaJ (Hsp40) homolog, subfamily C, member 12, dnaJ homolog subfamily C member 12, J domain containing protein 1 (JDP1), J domain protein 1, JDP1J domain-containing protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 56521 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction