Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DNAJC12 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15771820UL

 View more versions of this product

Catalog No. NBP15771820


Only null left
Add to Cart

Description

Description

DNAJC12 Polyclonal specifically detects DNAJC12 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DNAJC12
Polyclonal
Western Blot 1:100-1:2000
Q9UKB3
DNAJC12
Synthetic peptides corresponding to DNAJC12 (DnaJ (Hsp40) homolog, subfamily C, member 12) The peptide sequence was selected from the middle region of DNAJC12)(50ug). Peptide sequence EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE.
20 μL
Primary
Human
IgG
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
DnaJ (Hsp40) homolog, subfamily C, member 12, dnaJ homolog subfamily C member 12, J domain containing protein 1 (JDP1), J domain protein 1, JDP1J domain-containing protein 1
Rabbit
Affinity Purified
RUO
56521
Store at -20C. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.