Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | DNAJC22 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17932820
|
Novus Biologicals
NBP17932820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179328
|
Novus Biologicals
NBP179328 |
100 μL |
Each for $487.50
|
|
|||||
Description
DNAJC22 Polyclonal specifically detects DNAJC22 in Mouse samples. It is validated for Western Blot.Specifications
| DNAJC22 | |
| Polyclonal | |
| Rabbit | |
| NP_789805 | |
| 79962 | |
| Synthetic peptide directed towards the middle region of human 2810451A06Rik. Peptide sequence LVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DnaJ (Hsp40) homolog, subfamily C, member 22, dnaJ homolog subfamily C member 22, FLJ13236, wurst homolog, wus | |
| DNAJC22 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title