DNAJC5G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23848425UL

Catalog No. NB396806

Description

DNAJC5G Polyclonal specifically detects DNAJC5G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNAJC5G
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8N7S2
• Gene Symbols: DNAJC5G
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CSP-gamma, DnaJ (Hsp40) homolog, subfamily C, member 5 gamma, dnaJ homolog subfamily C member 5G, FLJ40417, gamma cysteine string protein, gamma-CSP, Gamma-cysteine string protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 285126
• Target Species: Human
• Isotype: IgG