Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJC5G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DNAJC5G |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DNAJC5G Polyclonal specifically detects DNAJC5G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DNAJC5G | |
Polyclonal | |
Rabbit | |
Human | |
Q8N7S2 | |
285126 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CSP-gamma, DnaJ (Hsp40) homolog, subfamily C, member 5 gamma, dnaJ homolog subfamily C member 5G, FLJ40417, gamma cysteine string protein, gamma-CSP, Gamma-cysteine string protein | |
DNAJC5G | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title