DNAJC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23874225UL

Catalog No. NB396690

Description

DNAJC6 Polyclonal specifically detects DNAJC6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNAJC6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: O75061
• Gene Symbols: DNAJC6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DJC6, DnaJ (Hsp40) homolog, subfamily B, member 6, DnaJ (Hsp40) homolog, subfamily C, member 6, DnaJ homolog subfamily C member 6, EC 3.1.3.48, KIAA0473auxilin, MGC129914, MGC129915, MGC48436, putative tyrosine-protein phosphatase auxilin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9829
• Target Species: Human
• Isotype: IgG