Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNASE2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162279
Description
DNASE2B Polyclonal specifically detects DNASE2B in Human samples. It is validated for Western Blot.Specifications
DNASE2B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
deoxyribonuclease II betaDNase2-like acid DNase, DLADdeoxyribonuclease-2-beta, DNase II beta, DNase II-like acid DNase, EC 3.1.22.1, Endonuclease DLAD, lysosomal DNase II | |
Rabbit | |
39 kDa | |
100 μL | |
Primary | |
Porcine: 86%; Rat: 86%; . | |
Human, Rat, Pig, Bovine, Equine, Guinea Pig | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8WZ79 | |
DNASE2B | |
Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG. | |
Affinity purified | |
RUO | |
58511 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction