Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNASE2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DNASE2B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DNASE2B Polyclonal specifically detects DNASE2B in Human samples. It is validated for Western Blot.Specifications
DNASE2B | |
Polyclonal | |
Rabbit | |
Q8WZ79 | |
58511 | |
Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
deoxyribonuclease II betaDNase2-like acid DNase, DLADdeoxyribonuclease-2-beta, DNase II beta, DNase II-like acid DNase, EC 3.1.22.1, Endonuclease DLAD, lysosomal DNase II | |
DNASE2B | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title