DNER Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179415

Catalog No. NBP179415

Description

DNER Polyclonal specifically detects DNER in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DNER
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, delta-notch-like EGF repeat-containing transmembrane, H_NH0150O02.1, UNQ26, WUGSC:H_NH0150O02.1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Canine: 85%; Bovine: 78%; Guinea pig: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: AAH24766
• Gene Symbols: DNER
• Immunogen: Synthetic peptide directed towards the middle region of human DNERThe immunogen for this antibody is DNER. Peptide sequence DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP.
• Quantity: 100 μL
• Research Discipline: Growth and Development, Neuronal Cell Markers
• Gene ID (Entrez): 92737
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG