Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNER Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00
Specifications
| Antigen | DNER |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17941520
|
Novus Biologicals
NBP17941520UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP179415
|
Novus Biologicals
NBP179415 |
100 μL | N/A | N/A | N/A | ||||
Description
DNER Polyclonal specifically detects DNER in Human samples. It is validated for Western Blot.Specifications
| DNER | |
| Polyclonal | |
| Purified | |
| RUO | |
| AAH24766 | |
| 92737 | |
| Synthetic peptide directed towards the middle region of human DNERThe immunogen for this antibody is DNER. Peptide sequence DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers | |
| bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, delta-notch-like EGF repeat-containing transmembrane, H_NH0150O02.1, UNQ26, WUGSC:H_NH0150O02.1 | |
| DNER | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title