Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), Novus Biologicals™

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), Novus Biologicals™
SDP

Catalog No. NBP234285F Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.02 mg
0.1 mg
0.2 mg
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP234285F 0.02 mg
NBP234285A 0.1 mg
NBP234285B 0.2 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Catalog No. NBP234285F Supplier Novus Biologicals Supplier No. NBP2342850.02MG
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen DOG1/TMEM16A
Applications Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone DG1/447 + DOG-1.1
Conjugate Unconjugated
Dilution Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
Formulation PBS with 0.05% BSA. with 0.05% Sodium Azide
Gene Accession No. Q5XXA6
Gene Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Gene Symbols ANO1
Host Species Mouse
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
Molecular Weight of Antigen 114 kDa
Purification Method Protein A purified
Quantity 0.02 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55107
Test Specificity Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Target Species Human
Content And Storage Store at 4C.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.