DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), Novus Biologicals™

Mouse Monoclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP234285F	Novus Biologicals NBP2342850.02MG	0.02 mg
NBP234285A	Novus Biologicals NBP2342850.1MG	0.1 mg
NBP234285B	Novus Biologicals NBP2342850.2MG	0.2 mg

Description

DOG1/TMEM16A Monoclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DOG1/TMEM16A
• Dilution: Western Blot 0.5-1.0ug/ml, Flow Cytometry 0.5-1ug/million cells, Immunocytochemistry/Immunofluorescence 0.5-1ug/ml, Immunoprecipitation 0.5-1ug/500ug protein lysate, Immunohistochemistry-Paraffin 0.5-1ug/ml, Immunohistochemistry-Frozen 0.5-1ug/ml
• Classification: Monoclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS with 0.05% BSA. with 0.05% Sodium Azide
• Gene Alias: ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
• Gene Symbols: ANO1
• Isotype: IgG
• Purification Method: Protein A purified
• Test Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

• Clone: DG1/447 + DOG-1.1
• Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Mouse
• Target Species: Human
• Gene Accession No.: Q5XXA6
• Gene ID (Entrez): 55107
• Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
• Primary or Secondary: Primary
• Content And Storage: Store at 4C.
• Molecular Weight of Antigen: 114 kDa