Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DOK5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15641120UL
Description
DOK5 Polyclonal specifically detects DOK5 in Human samples. It is validated for Western Blot.Specifications
DOK5 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9P104 | |
DOK5 | |
Synthetic peptides corresponding to DOK5(docking protein 5) The peptide sequence was selected from the N terminal of DOK5 (NP_060901). Peptide sequence GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD. | |
Affinity Purified | |
RUO | |
55816 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C20orf180, chromosome 20 open reading frame 180, dJ805C22.1, docking protein 5, Downstream of tyrosine kinase 5, Insulin receptor substrate 6, IRS6, IRS-6, MGC16926 | |
Rabbit | |
34 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction