Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP156918

Dopa Decarboxylase/DDC Antibody, Novus Biologicals™
SDP

Catalog No. NBP156918 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156918 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156918 Supplier Novus Biologicals Supplier No. NBP156918
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

Dopa Decarboxylase/DDC Polyclonal specifically detects Dopa Decarboxylase/DDC in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Dopa Decarboxylase/DDC
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P20711
Gene Alias AADCaromatic-L-amino-acid decarboxylase, DOPA decarboxylase, dopa decarboxylase (aromatic L-amino acid decarboxylase), EC 4.1.1, EC 4.1.1.28
Gene Symbols DDC
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DDC(dopa decarboxylase (aromatic L-amino acid decarboxylase)) The peptide sequence was selected from the N terminal of DDC (NP_000781). Peptide sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE.
Molecular Weight of Antigen 53 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 1644
Test Specificity Expected identity based on immunogen sequence: Chicken: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.