DORFIN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187989

Catalog No. NBP187989

Description

DORFIN Polyclonal specifically detects DORFIN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DORFIN
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: DKFZp566B1346, dorfin, Double ring-finger protein, E3 ubiquitin-protein ligase RNF19A, EC 6.3.2, EC 6.3.2.-, p38, protein p38 interacting with transcription factor Sp1, ring finger protein 19, RING finger protein 19 isoform, ring finger protein 19Ap38 protein, ring-IBR-ring domain containing protein Dorfin, RNF19
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RNF19A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 25897
• Target Species: Human
• Isotype: IgG

For Research Use Only