Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DORFIN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | DORFIN |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
DORFIN Polyclonal specifically detects DORFIN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DORFIN | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
DKFZp566B1346, dorfin, Double ring-finger protein, E3 ubiquitin-protein ligase RNF19A, EC 6.3.2, EC 6.3.2.-, p38, protein p38 interacting with transcription factor Sp1, ring finger protein 19, RING finger protein 19 isoform, ring finger protein 19Ap38 protein, ring-IBR-ring domain containing protein Dorfin, RNF19 | |
RNF19A | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
25897 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title