Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159367

DORFIN Antibody, Novus Biologicals™
SDP

Catalog No. NBP159367 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159367 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159367 Supplier Novus Biologicals Supplier No. NBP159367
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

DORFIN Polyclonal specifically detects DORFIN in Human samples. It is validated for Western Blot.

Specifications

Antigen DORFIN
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NV58
Gene Alias DKFZp566B1346, dorfin, Double ring-finger protein, E3 ubiquitin-protein ligase RNF19A, EC 6.3.2, EC 6.3.2.-, p38, protein p38 interacting with transcription factor Sp1, ring finger protein 19, RING finger protein 19 isoform, ring finger protein 19Ap38 protein, ring-IBR-ring domain containing protein Dorfin, RNF19
Gene Symbols RNF19A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RNF19A(ring finger protein 19A) The peptide sequence was selected from the N terminal of RNF19A. Peptide sequence IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 25897
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Guinea pig: 92%; Rat: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.