Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DPH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156748
Description
DPH4 Polyclonal specifically detects DPH4 in Human samples. It is validated for Western Blot.Specifications
DPH4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CSL-type zinc finger-containing protein 3, DnaJ (Hsp40) homolog, subfamily C, member 24, dnaJ homolog subfamily C member 24, DPH4 homolog, DPH4, JJJ3 homolog, DPH4, JJJ3 homolog (S. cerevisiae), DPH41700030A21Rik, JJJ3, S. cerevisiae), ZCSL3, zinc finger, CSL domain containing 3, zinc finger, CSL-type containing 3 | |
Rabbit | |
Affinity purified | |
RUO | |
120526 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6P3W2 | |
DNAJC24 | |
Synthetic peptides corresponding to DPH4 The peptide sequence was selected from the N terminal of DPH4. Peptide sequence MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Bovine: 85%;. | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction