DPH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156748

Catalog No. NBP156748

Description

DPH4 Polyclonal specifically detects DPH4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DPH4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CSL-type zinc finger-containing protein 3, DnaJ (Hsp40) homolog, subfamily C, member 24, dnaJ homolog subfamily C member 24, DPH4 homolog, DPH4, JJJ3 homolog, DPH4, JJJ3 homolog (S. cerevisiae), DPH41700030A21Rik, JJJ3, S. cerevisiae), ZCSL3, zinc finger, CSL domain containing 3, zinc finger, CSL-type containing 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 120526
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6P3W2
• Gene Symbols: DNAJC24
• Immunogen: Synthetic peptides corresponding to DPH4 The peptide sequence was selected from the N terminal of DPH4. Peptide sequence MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Bovine: 85%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG