DPPII/QPP/DPP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255799

Catalog No. NBP255799

Description

DPPII/QPP/DPP7 Polyclonal specifically detects DPPII/QPP/DPP7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DPPII/QPP/DPP7
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2, QPP, Quiescent cell proline dipeptidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DPP7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRG
• Quantity: 100 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 29952
• Target Species: Human
• Isotype: IgG

For Research Use Only