Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DRG1 Antibody, Novus Biologicals™

DRG1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15515820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15515820 20 μL
NBP155158 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15515820 Supplier Novus Biologicals Supplier No. NBP15515820UL

Description

Rabbit Polyclonal Antibody

DRG1 Polyclonal specifically detects DRG1 in Human samples. It is validated for Western Blot.

Specifications

Antigen DRG1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias developmentally regulated GTP binding protein 1, developmentally regulated GTP-binding protein 1, developmentally-regulated GTP-binding protein 1, DKFZp434N1827, DRG-1, NEDD3, NEDD-3, Neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3
Gene Symbols DRG1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL.
Molecular Weight of Antigen 26 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4733
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.