DRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23420525UL

Catalog No. NB397230

Description

DRP1 Polyclonal specifically detects DRP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DRP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: O00429
• Gene Symbols: DNM1L
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cell Biology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 10059
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DLP1, DRP1Dnm1p/Vps1p-like protein, DVLPEC 3.6.5.5, Dymple, DYMPLEDYNIV-11, dynamin 1-like, Dynamin family member proline-rich carboxyl-terminal domain less, dynamin-1-like protein, Dynamin-like protein, Dynamin-like protein 4, Dynamin-like protein IV, Dynamin-related protein 1, FLJ41912, HDYNIV, VPS1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only