Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DSCAM Antibody, Novus Biologicals™
SDP

Catalog No. NBP159208 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159208 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159208 Supplier Novus Biologicals Supplier No. NBP159208
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

DSCAM Polyclonal specifically detects DSCAM in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

Antigen DSCAM
Applications Western Blot, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60469
Gene Alias CHD2-42, CHD2-52, Down syndrome cell adhesion molecule, human CHD2-52 down syndrome cell adhesion molecule, 10CHD2
Gene Symbols DSCAM
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DSCAM(Down syndrome cell adhesion molecule) The peptide sequence was selected from the middle region of DSCAM (NP_001380). Peptide sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV.
Molecular Weight of Antigen 222 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1826
Test Specificity Expected identity based on immunogen sequence: Xenopus: 85%.
Reconstitution Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.