Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DULLARD Antibody, Novus Biologicals™
SDP

Catalog No. NBP159364 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159364 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159364 Supplier Novus Biologicals Supplier No. NBP159364
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

DULLARD Polyclonal specifically detects DULLARD in Human samples. It is validated for Western Blot.

Specifications

Antigen DULLARD
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95476
Gene Alias CTD nuclear envelope phosphatase 1, DULLARD, dullard homolog, dullard homolog (Xenopus laevis), EC 3.1.3.16, HSA011916, NET56, Serine/threonine-protein phosphatase dullard
Gene Symbols CTDNEP1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DULLARD(dullard homolog (Xenopus laevis)) The peptide sequence was selected from the middle region of DULLARD. Peptide sequence HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23399
Test Specificity Expected identity based on immunogen sequence: Green puffer: 100%; Western clawed frog: 100%; Channel catfish: 100%; Blood fluke: 100%; Atlantic salmon: 100%; Trichoplax reptans: 100%; Harpegnathos saltator: 92%; Yellowfever mosquito: 92%; Silk moth: 92%; African malaria mosquito: 92%; Camponotus floridanus: 92%; Body louse: 92%; Red flour beetle: 92%; Pea aphid: 92%; Florida lancelet: 92%; Black-legged tick: 92%; Fruit fly: 92%; Acorn worm: 92%; Starlet sea anemone: 90%;.
Reconstitution Centrifuge at 12,000 x g for 20 seconds. Reconstitute with 50 ul distilled water to a final concentration of 1.0 mg/ml in PBS buffer. Vortex followed by centrifuge again to pellet the solution.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.