DUSP22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18307825UL

Catalog No. NB433195

Description

DUSP22 Polyclonal specifically detects DUSP22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DUSP22
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: dual specificity phosphatase 22, dual specificity protein phosphatase 22, EC 3.1.3.16, EC 3.1.3.48, FLJ35864, homolog of mouse dual specificity phosphatase LMW-DSP2, JKAP, JNK-stimulating phosphatase 1, JSP-1, JSP1JNK-stimulatory phosphatase-1, LMWDSP2, LMW-DSP2, Low molecular weight dual specificity phosphatase 2, Mitogen-activated protein kinase phosphatase x, MKP-x, MKPXMAP kinase phosphatase x, VHX
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DUSP22
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
• Quantity: 25 μL
• Research Discipline: GPCR, MAP Kinase Signaling, Protein Phosphatase
• Gene ID (Entrez): 56940
• Target Species: Human
• Isotype: IgG

For Research Use Only