Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUSP7 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310614100UL
Description
DUSP7 Polyclonal specifically detects DUSP7 in Rat samples. It is validated for Western Blot.Specifications
DUSP7 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DKFZp586F2224, dual specificity phosphatase 7, Dual specificity protein phosphatase PYST2, dual-specificity phosphatase-7, EC 3.1.3.16, EC 3.1.3.48, MKPX, MKP-X, PYST2dual specificity protein phosphatase 7 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat DUSP7 (XP_238551). Peptide sequence ATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCET | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
1849 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction