Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUSP7 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | DUSP7 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DUSP7 Polyclonal specifically detects DUSP7 in Rat samples. It is validated for Western Blot.Specifications
| DUSP7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| DKFZp586F2224, dual specificity phosphatase 7, Dual specificity protein phosphatase PYST2, dual-specificity phosphatase-7, EC 3.1.3.16, EC 3.1.3.48, MKPX, MKP-X, PYST2dual specificity protein phosphatase 7 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat DUSP7 (XP_238551). Peptide sequence ATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCET | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 1849 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title