DUSP8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158302

Catalog No. NBP158302

Description

DUSP8 Polyclonal specifically detects DUSP8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DUSP8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C11orf81, chromosome 11 open reading frame 81, dual specificity phosphatase 8, Dual specificity protein phosphatase hVH-5, EC 3.1.3.16, EC 3.1.3.48, FLJ42476, FLJ42958, HVH8, serine/threonine specific protein phosphatase, vaccinia virus homolog, VH5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Mouse: 100%; Guinea pig: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13202
• Gene Symbols: DUSP8
• Immunogen: Synthetic peptides corresponding to DUSP8(dual specificity phosphatase 8) The peptide sequence was selected from the middle region of DUSP8. Peptide sequence PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP.
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia, Signal Transduction
• Gene ID (Entrez): 1850
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.