DYNC2H1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23843725UL

Catalog No. NB436208

Description

DYNC2H1 Polyclonal specifically detects DYNC2H1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DYNC2H1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8NCM8
• Gene Symbols: DYNC2H1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATD3, DHC1B, DHC2, DNCH2, DYH1B, dynein cytoplasmic heavy chain 2, dynein heavy chain 11, dynein, cytoplasmic 2, heavy chain 1, dynein, cytoplasmic, heavy polypeptide 2, FLJ11756, hdhc11, isotype 1B, KIAA1997
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79659
• Target Species: Human
• Isotype: IgG