Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Dynein intermediate chain 2 Antibody, Novus Biologicals™

Dynein intermediate chain 2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18050920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18050920 20 μL
NBP180509 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18050920 Supplier Novus Biologicals Supplier No. NBP18050920UL

Description

Rabbit Polyclonal Antibody

Dynein intermediate chain 2 Polyclonal specifically detects Dynein intermediate chain 2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Dynein intermediate chain 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_075462
Gene Alias Axonemal dynein intermediate chain 2, CILD9, dynein intermediate chain 2, axonemal, dynein, axonemal, intermediate chain 2, dynein, axonemal, intermediate polypeptide 2
Gene Symbols DNAI2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human DNAI2. Peptide sequence TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64446
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.