Dynein light chain 2 cytoplasmic Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154377

Catalog No. NBP154377

Description

Dynein light chain 2 cytoplasmic Polyclonal specifically detects Dynein light chain 2 cytoplasmic in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Dynein light chain 2 cytoplasmic
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DLC2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22
• Host Species: Rabbit
• Molecular Weight of Antigen: 10 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FJ2
• Gene Symbols: DYNLL2
• Immunogen: Synthetic peptides corresponding toDynein light chain 2 cytoplasmic(dynein, light chain, LC8-type 2) The peptide sequence was selected from the N terminal of Dynein light chain 2 cytoplasmic. Peptide sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140735
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only