Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. dystrophia myotonica containing WD repeat motif Antibody, Novus Biologicals™

dystrophia myotonica containing WD repeat motif Antibody, Novus Biologicals™
SDP

Catalog No. NB395591 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395591 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395591 Supplier Novus Biologicals Supplier No. NBP24962225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

dystrophia myotonica containing WD repeat motif Polyclonal antibody specifically detects dystrophia myotonica containing WD repeat motif in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen dystrophia myotonica containing WD repeat motif
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias D19S593E, DM9, DMRN9, DMR-N9, dystrophia myotonica WD repeat-containing protein, dystrophia myotonica, WD repeat containing, dystrophia myotonica-containing WD repeat motif, Dystrophia myotonica-containing WD repeat motif protein, gene59, Protein 59, Protein DMR-N9
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 1762
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.