Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

E-Cadherin Antibody (CL1172), Novus Biologicals™
SDP

Catalog No. NB397211 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397211 25 μL
NBP234476 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397211 Supplier Novus Biologicals Supplier No. NBP23447625UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

E-Cadherin Monoclonal specifically detects E-Cadherin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen E-Cadherin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL1172
Conjugate Unconjugated
Dilution Western Blot 1 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
Gene Accession No. P12830
Gene Alias Arc-1, cadherin 1, E-cadherin (epithelial), cadherin 1, type 1, E-cadherin (epithelial), cadherin-1, calcium-dependent adhesion protein, epithelial, CAM 120/80, CD324, CD324 antigen, CDHE, cell-CAM 120/80, ECAD, E-cadherin, Epithelial cadherin, LCAM, UVOE-Cadherin, uvomorulin
Gene Symbols CDH1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 999
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.