E6AP/UBE3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189092

Catalog No. NBP189092

Description

E6AP/UBE3A Polyclonal antibody specifically detects E6AP/UBE3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: E6AP/UBE3A
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ANCREPVE6AP, AS, CTCL tumor antigen se37-2, E6AP, E6-AP, E6AP ubiquitin-protein ligase, EC 6.3.2.-, FLJ26981, HPVE6A, human papilloma virus E6-associated protein, Human papillomavirus E6-associated protein, Oncogenic protein-associated protein E6-AP, Renal carcinoma antigen NY-REN-54, ubiquitin protein ligase E3A, ubiquitin-protein ligase E3A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human E6AP/UBE3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UBE3A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Transcription Factors and Regulators
• Gene ID (Entrez): 7337
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only