Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
E6AP/UBE3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | E6AP/UBE3A |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
E6AP/UBE3A Polyclonal antibody specifically detects E6AP/UBE3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
E6AP/UBE3A | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
ANCREPVE6AP, AS, CTCL tumor antigen se37-2, E6AP, E6-AP, E6AP ubiquitin-protein ligase, EC 6.3.2.-, FLJ26981, HPVE6A, human papilloma virus E6-associated protein, Human papillomavirus E6-associated protein, Oncogenic protein-associated protein E6-AP, Renal carcinoma antigen NY-REN-54, ubiquitin protein ligase E3A, ubiquitin-protein ligase E3A | |
UBE3A | |
IgG | |
Affinity Purified | |
Specificity of human E6AP/UBE3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Apoptosis, Transcription Factors and Regulators | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
7337 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title