EAAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162519

Catalog No. NBP162519

Description

EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EAAT3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P43005
• Gene Symbols: SLC1A1
• Immunogen: The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6505
• Reconstitution: Reconstitute with 50μL distilled water to a final concentration of 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.