Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EAAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16251920UL
Description
EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.Specifications
| EAAT3 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| P43005 | |
| SLC1A1 | |
| The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN. | |
| Affinity Purified | |
| RUO | |
| 6505 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1 | |
| Rabbit | |
| 57 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction