EAAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16251920UL

Catalog No. NBP16251920

Description

EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EAAT3
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: P43005
• Gene Symbols: SLC1A1
• Immunogen: The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6505
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG