Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EAAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159880
Description
EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.Specifications
| EAAT3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1 | |
| Rabbit | |
| 57 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Mouse: 84%; Canine: 76%. | |
| Human, Mouse, Rat, Canine | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P43005 | |
| SLC1A1 | |
| Synthetic peptides corresponding to SLC1A1(solute carrier family 1 (neuronal high affinity glutamate transporter), member 1) The peptide sequence was selected from the N terminal of SLC1A1 (NP_004161). LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 6505 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction