EARS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156400

Catalog No. NBP156400

Description

EARS2 Polyclonal specifically detects EARS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EARS2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.1.1.17, GluRS, Glutamate--tRNA ligase, glutamyl-tRNA synthetase 2, mitochondrial (putative), KIAA1970glutamate tRNA ligase 2, mitochondrial, MSE1, probable glutamyl-tRNA synthetase, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Chicken: 85%; Canine: 85%; Equine: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86YH3
• Gene Symbols: EARS2
• Immunogen: Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 124454
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.